🧬 2019-nCoV + HIV-1 = PlagueInc_IRL ?

Posted: 2020-02-04 in Долбы, По жизни
Метки:

На фоне окуительных новостей из Китая нашёл тут весьма стрёмную статью:

Uncanny similarity of unique inserts in the 2019-nCoV spike protein to HIV-1 gp120 and Gag

Исследователи из Индии утверждают, что вирус, вызвавший столько паники, нифига не природного зоонозного происхождения, а генный модификат. С помощью современных методов секвенирования и анализа баз данных по вирусным геномам товарищи учёные выявили четыре вставки нуклеотидных цепочек / соответствующих белков, которые отсутствуют во всём семействе коронавирусов. Зато эти необычные фрагменты “GTNGTKR” (IS1), “HKNNKS” (IS2), “GDSSSG” (IS3), “QTNSPRRA” (IS4) были найдены в дампах генома HIV-1, то бишь печально всем известной ВИЧ-инфекции.

Причем фрагменты там от разных разновидностей ВИЧ — тайландской, кенийской и индийской. И сразу четыре сегмента. Конечно, существуют всякие эффекты переноса генов, мутации вирусной РНК и прочие вещи мира молекулярной биологии, но 4 сегмента сразу, от опаснейшей для человека инфекции, с точным совпадением нуклеотидов и заимствованием от ВИЧ трёх разных тиипов — это очень странно. Получается, инфицированное дикое животное должно было не просто быть заражено коронавирусом, но и параллельно таскать в себе каким-то образом части геномов от трёх разных ВИЧ-инфекций.

Так что есть весомое подозрение, что ебанутые вояки таки не успокоились насчёт биологического оружия, и втихарец экспериментировали со всякой опасной дрянью. Но потом «что-то пошло не так», боевая вирусня вырвалась на свободу и пошла массово заражать китайцев.

В этом ключе становятся понятны и цензурное замалчивание Китаем событий 2003 года (там был вирь того же семейства), и текущие действия с перекрытием границ, ударными стройками госпиталей и карантином многомиллионных городов в Китае.

Вариантов, кто мог такое сделать — всего два. Либо сами китайцы устроили себе Plague Inc IRL, неаккуратно что-то вылив в канализацию, либо им помогли США в рамках своей объявленной торговой войны. Больше заинтересованных сторон я не вижу.

Отправил статейку одному знакомому, специализирующемуся на молекулярной генетике, интересно будет услышать его комментарии.

ещё ключевое: RTYLFNETRGNSSSG QTNSSILMQRSNFKGPRRA

[2020-02-09 pull request] И товарищ таки мне ответил. Я процитирую его ответ целиком. Если вам стало ещё более непонятно — простите, но такова сложность молекулярной биологии.


1. Аффтар приводит выравнивание всего двух короновирусов, хотя и "наиболее близких", но выравнивает он белковые последовательности, а не нуклеотидные.
2. IS3 - на самом деле три аминокислоты. Вообще, про "вставку" можно было бы сказать только в случае IS1, в остальных случаях, там и замены. Да и вообще, почему он прицепился к «вставкам» то там, вообще, много различий?
3. "Затем мы транслировали выровненные геномы." Интересно, до этого авторы показывают нам на картинке 2 таки белковые последовательности, говорят про вставки, а теперь они зачем-то транслируют ГЕНОМЫ, да ещё и выровненные.
4. И вообще, на той же картинке, выравнивание двух молекул у почему-то называется множественным выравниванием.
5. И опять к той же картинке. Там дана ссылка на весь геном вируса, а не на нарисованный белок. Ну ладно, мы не гордые.
6. Авторы сравнивают последовательности с двумя абсолютно разными белками HIV-1 что есмь круто почему же именно HIV?
7. Цитирую "Вставки 1 и 2 по 6 аминокислот на 100% идентичны ..." чему-то там в ВИЧ-е, то есть 12 аминокислот в сумме. Но 100% это круче.
8. Вставка 3 - куда эпичнее: на картинке 2 нам сказали что третья вставка - 6 аминокислот, но потом автор передумал и насчитал 12, которые ну никак вставкой не являются, но так как-то лучше выравнивалось.
9. Простите, мой клатчский, но primary sequence of protein это звучит как мужской половой хуй. Первичная структура - это уже последовательность.
10. Необычные для научной литературы слова: fortuitous (3 раза в одном абзаце), uncanny, startling.
11. Аффтар жжот нипадецки с изоэлектрическими точками белков. Полагаю, что тот факт, что белок(S) отвечает за адсорбцию вируса, намекает нам, что его заряд будет комплементарный тому, к чему он присоединяется. В этом свете пептиды этого белка, вполне себе могут нести положительный заряд. {Зануда}"Большинство их значений было 10+-2" Не большинство а среднее, вот только к чему оно тут то? {/Зануда}
12. "Так как эти 4 вставки уникальны для этого коронавируса - они идеальные кандидаты для праймеров, нужных чтобы различать этот самый вирус." Здесь становится ясно, что аффтар креатива не нюхал лаборатории. Во первых то что последовательности уникальны, ещё не значит, что к ним будут отжигаться праймеры. Во вторых, это БЕЛКОВЫЕ последовательности БЛДЖАД. Нам ни разу не показали собственно выравнивание РНК ни, сука, разу (в доп. Материале выравниваются только разные варианты «вставки» нового вируса)! А что если там отличия в последней букве кодона?
13. На картинке 3 аффтар уже уверен, что имеет дело со вставкой из ВИЧ.
14. На той же картинке нарисован белокЪ и в тексте говорится, что это часть рецептора, но почему-то сам рецептор нигде не отмечен. Есть, правда ссылка на другую статью... Но в статье, изобличающей масонский заговор рецептор нарисовать всё-таки надо WAIT OH SHI~.
15. В обсуждении аффтар утверждает, что именно из-за того, что в белке появились «вставки», он приобрёл сродство к человеческому рецептору. Чтоа? Обратимся опять к картинке 2. За связывание с клеткой хозяина отвечает N-концевой домен белка S — это как раз та часть, где так много несоответствий в выравнивании (синий текст на картинке). Но автор почему-то придерживается логики, раз эти вставки похожи на пептиды gp120, то уж они то точно отвечают за инфекционность вируса. Почему из всех изменений эти самые важные? Gp120, к тому же имеет разные области. И кстати, к какому рецептору присоединяется злополучный белок S? Про это не сказано ни слова, но во всём виноват gp120.
16. Кстати, автор очень горд 3D моделью бека… На саму картинку 3 в тексте есть ссылка, но там она идёт под номером 4. Проблема в том, что белок который он для этого использовал — другой и у него нет всех замен из предыдущего пункта, то есть последовательность рецептора у него другая, а значит построение его модели сродни гаданию на кофейной гущи.

А теперь немного биологии. Итак, основной аргумент статьи в том, что в S белке шипиков нового вируса есть 4 подозрительных вставки, которые идентичны по своей последовательности двум разным белков вируса иммунодефицита человека. Вообще S белок отвечает за присоединение и слияние вируса с клеткой хозяина, и, конечно, при исследовании механизмов патогенеза новых коронавирусов этот белок представляет наибольший интерес. Таким образом наш герой правильно выбрал цель. А теперь следите за руками.
Я сделал такое же выравнивание, как и автор статьи, я нашёл его «вставки», хотя у меня выравнивание несколько отличалось, что связано с тем, что я использовал другое ПО.
Семейство алгоритмов BLAST занимается тем, что гуглит последовательности того, что мы ему предлагаем по базе данных Национального Института Здравоохранения (NCBI) [США].
Давайте сделаем поиск гексапептида первой вставки GTNGTKR, используя BLASTp.
О чудо! Мы нашли 59 полипептидов со 100%© соответствием. Первый — это какой-то tank-1 из круглого червя Pristionchus pacificus. Однако, может быть, просто в этом черве есть ретровирусные элементы, которые идентичны гексапептиду из вируса СПИД-а? Давайте смотреть дальше: мы видим уже знакомый нам коронавирус, но вот мы встречаем DNA polymerase III subunit alpha [Ignavibacteriae bacterium HGW-Ignavibacteriae-4]. А это уже бактерия… Дальше — больше. Иными словами, даже если этот пептид и встречается в каком-то белке ВИЧ, он никак не может являться его сигнатурой.
Теперь возьмём второй олигопептид: HKNNKS. У меня он так красиво не выровнялся, но ладно. Тут у меня выпало 100 белков со 100%© совпадением. Там есть как варианты одного белка так и белки из разных организмов, такой гексапептид есть даже у плодовой мушки Drosophila obscura.
Последовательность RSYLTPGDSSSG вообще не видится у меня как «вставка». Но ничего, ищем в базе данных! Вот тут то наш герой обосрался как надо последовательность прямо вот так вот выравнивается к, цитирую, «spike glycoprotein [Bat coronavirus]»! А нам то сказали, что его там нетъ :). Даже у нашего героя выравнивание с ВИЧ не получилось, см. Таблицу 1 в оригинальном креативе. Например, не идеальное выравнивание намного лучше проходит с ABC-type multidrug transport system fused ATPase/permease subunit [Propioniferax innocua].
И, последний, по порядку, но не по значению пептид QTNSPRRA. Этот прекрасно выравнивается с каким-то белком грибка Aspergillus versicolor. И ещё какими-то другими белками.
А как же ВИЧ, спросит меня внимательный читатель. Давайте смотреть… Итак Аффтар сказал что это ВИЧ первого типа, на этот раз не дал нам даже ссылку на его последовательность, раз так то возьмём вот этот gp 120 https://www.uniprot.org/uniprot/P04578. Вот она, кстати
MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVP
TDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKG
EIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKC
NNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTR
KRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGG
EFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTR
DGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGIGALFLGFLGAAGSTMGA
ASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAV
PWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKL
FIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDL
RSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGA
CRAIRHIPRRIRQGLERILL

GTNGTKR — не найден, HKNNKS — неа, RSYLTPGDSSSG тоже нет, я пробовал искать куски, которые точно совпадали у автора.
А это gag:
MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRS
LYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNA
WVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREP
RGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQ
ASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRN
QRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEES
FRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ

И тут тоже ничего не найдено ни QTNS, ни PRRA…

Самое печальное, что автор не дал нам ссылки на последовательности вируса СПИДа, с которыми он работал, эти последовательности очень сильно меняются, чем и обусловлена сложность лечения заболевания.
Выводы:
1. Гексопептидов маловато для того, чтобы утверждать принадлежность последовательности к какому-либо организму.
2. Эта статья не подвергалась никаким рецензиям, судя по числу хотя бы только ляпов и перлов в тексте. Согласно википедии bioRxiv не рецензируется «As preprints, papers hosted on bioRxiv are not peer-reviewed, but undergo basic screening and checked against plagiarism.»
3. Авторы хотели стать богатым и знаменитым на фоне эпидемии.
4. Вообще сам белок S очень интересный и, если кому-то нравится биохимия и генетика патогенных организмов, я очень рекомендую статью (Structure, Function, and Evolution of Coronavirus Spike Proteins, Fang Li, 2016)

К чему я это всё тут написал ? А к тому, что для уверенных утверждений надо иметь овердохера специальных знаний и некисло разбираться в предмете. К тому, что публикация в журнале ещё ничего не значит, особенно — в нерецензируемом. И даже в рецензируемом может быть бредятинка или откровенно слабые и притянутые за уши утверждения. Но так и работает наука — на гипотезах, предположениях и проверках. И на начальных этапах самый правильный ответ — «не знаю». Будем смотреть, что ещё там наковыряют.

Простите, если процитированный ответ моего друга убил вам мозг. И от поездок в Китай пока воздержитесь, мало ли чего.

- комментарии
  1. Алексей:

    Афтор, рекомендую к просмотру https://youtu.be/yDX4ZdMUehQ
    Может созреет идейка для новой статьи ))

Добавить комментарий

Заполните поля или щелкните по значку, чтобы оставить свой комментарий:

Логотип WordPress.com

Для комментария используется ваша учётная запись WordPress.com. Выход /  Изменить )

Google photo

Для комментария используется ваша учётная запись Google. Выход /  Изменить )

Фотография Twitter

Для комментария используется ваша учётная запись Twitter. Выход /  Изменить )

Фотография Facebook

Для комментария используется ваша учётная запись Facebook. Выход /  Изменить )

Connecting to %s

This site uses Akismet to reduce spam. Learn how your comment data is processed.